DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP010619

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001230717.2 Gene:AgaP_AGAP010619 / 4577722 VectorBaseID:AGAP010619 Length:280 Species:Anopheles gambiae


Alignment Length:281 Identity:76/281 - (27%)
Similarity:120/281 - (42%) Gaps:44/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLC-----------------AAGVLAQNDSVVEP-------RIVGGTKAREGQFPHQISLRRR 48
            |::||                 .|.||.:.::|.|.       ||:.|..:....:|..||:||.
Mosquito     7 LVILCLFYSNVVSANGNEKATAEAAVLVKAENVTEAEAAAQSGRIINGFASDIANYPFAISVRRD 71

  Fly    49 GSHTCGGSIISKDYVVTAAHCVKQGNNVAP-ANELEIQAGSLLLSSGGVRVPVATVTVH----PN 108
            |...|||::||..|.:|||      ..|.| .|.:.:..||...:||||...|..:.||    ||
Mosquito    72 GQFYCGGTVISASYALTAA------TPVYPYRNSITLYGGSTSANSGGVLFKVLMIAVHLLFNPN 130

  Fly   109 YNSNGHDVAVLRL-RNSLTFNSNIAAIKLATEDPPNDATVDISGWGAISQR--GPISNSLLYVQV 170
            ...:.:::|:|.: .|:.....|||.|.||:.:........:.|||..:..  || :|:|....:
Mosquito   131 DRVSDYNIAILTVPANAFGGRRNIAPIPLASAEVAIGTKCTVFGWGRTNANLPGP-ANALRSADM 194

  Fly   171 KALSRESCQKTY---LRQLPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAP 232
            ...|..:|.:.:   ..||....:|....:....|.||.|.....:|||.|:|.....||.....
Mosquito   195 VISSGATCARAWGPLSVQLTSNMICAKGVRGADLCIGDYGNALVCRGKLNGIAFLASPGCDNTRD 259

  Fly   233 DGYERVSK--LRNWIAEKASL 251
            ..|.|:::  :|.:|..:..:
Mosquito   260 SVYMRITEYNIRRFIRSQTGV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/230 (29%)
Tryp_SPc 28..248 CDD:238113 67/232 (29%)
AgaP_AGAP010619XP_001230717.2 Tryp_SPc 50..268 CDD:214473 66/224 (29%)
Tryp_SPc 51..268 CDD:238113 65/223 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.