DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP010620

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001230718.2 Gene:AgaP_AGAP010620 / 4577717 VectorBaseID:AGAP010620 Length:262 Species:Anopheles gambiae


Alignment Length:263 Identity:77/263 - (29%)
Similarity:122/263 - (46%) Gaps:19/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWTSLLVLCAAGVLAQNDSVVEP-RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAA 67
            |..|..||...|:....::..:. ||:.|......::|..:||||.|...||.::||..:.:|||
Mosquito     4 FLVSSFVLRNCGLSEIPEAAAQSGRIINGFSVEIAKYPFVLSLRRDGKFDCGATVISLSHALTAA 68

  Fly    68 HCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNS----NGHDVAVLRL-RNSLTF 127
            ..:....| :| ..:.:..||...:||||...|..:.||||||.    :..::|||.: .|:...
Mosquito    69 ASIYPYRN-SP-QRMTLYGGSTSPTSGGVSFSVLRIAVHPNYNPIVRVSDFNIAVLTVPTNAFRA 131

  Fly   128 NSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRE-SCQKTYLRQLPE--- 188
            ..|||.|.||:..........:.|||:.:...|...:.|......:|.| :|.:.:| |||.   
Mosquito   132 KRNIAPIPLASSVVETGTKCSVFGWGSTNYYIPAPATTLRAADMVISSEATCARAWL-QLPSPVV 195

  Fly   189 -TTMCLLHPKDKGA--CYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERV--SKLRNWIAEK 248
             |:..:....|:||  |.||||......|:|.|:| .:...||......|.::  |.:|::|..:
Mosquito   196 ITSNMVCAKGDRGADLCTGDSGNALVCSGRLTGVA-ILSNTCGNGRDTAYTKITASSVRSFIRSQ 259

  Fly   249 ASL 251
            ..:
Mosquito   260 TGV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/231 (31%)
Tryp_SPc 28..248 CDD:238113 71/233 (30%)
AgaP_AGAP010620XP_001230718.2 Tryp_SPc 28..256 CDD:214473 71/231 (31%)
Tryp_SPc 29..259 CDD:238113 71/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.