DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP012842

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001230353.1 Gene:AgaP_AGAP012842 / 4397614 VectorBaseID:AGAP012842 Length:110 Species:Anopheles gambiae


Alignment Length:104 Identity:31/104 - (29%)
Similarity:49/104 - (47%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 ISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQ---LPETTMCLLHPK-DKGACYGDSGGP 209
            :||||........::.|....|..::::.|.|.|...   :.:...|..:.: .:..|..|||||
Mosquito     4 VSGWGLTLSDADSNDVLRATNVPTVNQQECNKAYQSMYGGITDQMFCAGYKQGGQDTCRQDSGGP 68

  Fly   210 ATYQGKLVGLASFVIGG--CGRAA-PDGYERVSKLRNWI 245
            ...:|||:|:.|:   |  |..|. |..|.||:..|:||
Mosquito    69 FVAEGKLIGVISW---GHECALAGYPGVYARVASARDWI 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 29/102 (28%)
Tryp_SPc 28..248 CDD:238113 31/104 (30%)
AgaP_AGAP012842XP_001230353.1 Tryp_SPc <1..107 CDD:238113 31/104 (30%)
Tryp_SPc <1..104 CDD:214473 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.