DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and KLK12

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:241 Identity:72/241 - (29%)
Similarity:107/241 - (44%) Gaps:36/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQG 73
            |:||..|:    .....|:|..||:......|.|:.|....|..|||.:|...:|:|||||    
Human     7 LLLCVLGL----SQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHC---- 63

  Fly    74 NNVAPANELEIQAGSLLLS----SGGVRVPVATVTVHPNY----NSNGHDVAVLRLRNSLTFNSN 130
                ..:...::.|...||    :..:|....:|| ||.|    .|:.||:.:||||..:...|:
Human    64 ----SGSRYWVRLGEHSLSQLDWTEQIRHSGFSVT-HPGYLGASTSHEHDLRLLRLRLPVRVTSS 123

  Fly   131 IAAIKLATEDPPNDATV-----DISGWGAISQ-RGPISNSLLYVQVKALSRESCQKTYLRQLPET 189
            :..:.|     |||...     .:||||..:. |.|..:.|..:.:..:|..:|...|..::...
Human   124 VQPLPL-----PNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSN 183

  Fly   190 TMCLLHPKDKGACYGDSGGPATYQGKLVGLASF-VIGGCGRAAPDG 234
            .:|......:.||.||||||....|.|.||.|: .:|.||:   ||
Human   184 MVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQ---DG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/223 (30%)
Tryp_SPc 28..248 CDD:238113 67/222 (30%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 67/223 (30%)
Tryp_SPc 22..236 CDD:238113 67/222 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.