DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG34130

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:231 Identity:53/231 - (22%)
Similarity:94/231 - (40%) Gaps:36/231 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RRRGSH--------------TCGGSIISKDYVVTAAHCVKQGNNVAPANELEI-----QAGSLLL 91
            |..|.|              .||.|.:|..|.:|:|:|:....:...:..:|:     :..:.|.
  Fly    48 RTSGGHAVPWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSRQDNQLD 112

  Fly    92 SSGGVRVPVATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWGA 154
            |.......:..:.|..:::..|  .||||:.|.|.|..|.| ..:.|.|....:..::.:..:||
  Fly   113 SHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLRGNRN-NYVTLCTNPLSSYKSLSVVSYGA 176

  Fly   155 ISQRGPISNSLLYVQVKALSRESCQKTY----LRQLPETTMCLLHPKDKGACYGDSGGPATYQGK 215
                ||..| :...:::.|:|..|...|    ||   ||..|....|....|...:|.|.|...:
  Fly   177 ----GPAEN-VRTEEIEVLNRMICDSAYGNFLLR---ETVACAKEFKRSADCMFSAGCPVTAGDQ 233

  Fly   216 LVGLASFVIGGCGRA-APDGYERVSKLRNWIAEKAS 250
            |.|:.:: ...|.|: .|..:..:.:::.:|.:..|
  Fly   234 LCGIVAW-SPACKRSNLPGIFTDIHQVKRFILKAIS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 51/224 (23%)
Tryp_SPc 28..248 CDD:238113 52/227 (23%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 49/219 (22%)
Tryp_SPc 53..256 CDD:304450 49/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.