DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and zgc:92313

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001002596.1 Gene:zgc:92313 / 436869 ZFINID:ZDB-GENE-040718-339 Length:309 Species:Danio rerio


Alignment Length:274 Identity:83/274 - (30%)
Similarity:122/274 - (44%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTSLLVLCAAGVLAQNDSVVEP---RIVGGTKAREGQFPHQISLR-RRGSHTCGGSIISKDYVVT 65
            |..|:||....|....:....|   |||||:.|.:|.:|.|:.:: .:..|.|||:|||:::|::
Zfish     9 WIVLVVLNGLWVGEAQECGRPPMINRIVGGSSAADGAWPWQVDIQGEKSKHVCGGTIISENWVLS 73

  Fly    66 AAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVP------VATVTVHPNYNSN--GHDVAVLRLR 122
            ||||....|::   :...|.||...|:...   |      ::.|.|...|...  |.|:|::.|.
Zfish    74 AAHCFPNPNDI---SGYLIYAGRQQLNGWN---PDETSHRISRVVVPLGYTDPQLGQDIALVELA 132

  Fly   123 NSLTFNSNIAAIKL--ATEDPPNDATVDISGWG------AISQRGPISNSLLYVQVKALSRESCQ 179
            ....:...|..:.|  |..:..:|....|:|||      |:...||:..    |||..:..:.||
Zfish   133 TPFVYTERIQPVCLPYANVEFTSDMRCMITGWGDIREGVALQGVGPLQE----VQVPIIDSQICQ 193

  Fly   180 KTYLRQLPET------TMCL-LHPKDKGACYGDSGGPATYQ---GKLV--GLASFVIGGCGRA-A 231
            ..:|....|.      .||. .....|.:|.||||||...|   |..|  |:.||.: ||..| .
Zfish   194 DMFLTNPTENIDIRPDMMCAGFQQGGKDSCQGDSGGPLACQISDGSWVQAGIVSFGL-GCAEANR 257

  Fly   232 PDGYERVSKLRNWI 245
            |..|.:||...|:|
Zfish   258 PGVYAKVSSFTNFI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 76/247 (31%)
Tryp_SPc 28..248 CDD:238113 76/248 (31%)
zgc:92313NP_001002596.1 Tryp_SPc 34..271 CDD:214473 76/247 (31%)
Tryp_SPc 35..274 CDD:238113 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.