DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Try10

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001034085.1 Gene:Try10 / 436522 MGIID:3687012 Length:246 Species:Mus musculus


Alignment Length:253 Identity:73/253 - (28%)
Similarity:113/253 - (44%) Gaps:28/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCV 70
            ::||.|...|.........:.:||||...||...|:|:|| ..|.|.||||:|:..:||:||||.
Mouse     2 STLLFLALVGAAVAFPVDDDDKIVGGYTCRENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHCY 65

  Fly    71 K---------QGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNS 124
            |         ...||...||..|.|              |.:..||.:...  .:|:.:::|.:.
Mouse    66 KSRIQVRLGEHNINVLEGNEQFIDA--------------ANIIKHPKFKKKTLDNDIMLIKLSSP 116

  Fly   125 LTFNSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLY-VQVKALSRESCQKTYLRQLPE 188
            :|.|:.:|.:.|.:..........|||||.....|..:..||. :....|.:..|:.:|..::.:
Mouse   117 VTLNARVATVALPSSCAAAGTQCLISGWGNTLSSGVNNPDLLQCLDAPLLPQADCEASYPGKITK 181

  Fly   189 TTMCL-LHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            ..:|: .....|.:|.||||||....|:|.|:.|:..|...:..|..|.:|....:||
Mouse   182 NMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/230 (29%)
Tryp_SPc 28..248 CDD:238113 69/231 (30%)
Try10NP_001034085.1 Tryp_SPc 23..239 CDD:214473 67/230 (29%)
Tryp_SPc 24..242 CDD:238113 69/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.