DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG11313

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:279 Identity:70/279 - (25%)
Similarity:119/279 - (42%) Gaps:55/279 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NDSVV------EPRIVGG-------TKARE---GQFPHQISLRRR---GSHT---CGGSIISKDY 62
            ||.|:      :..|.||       ||..|   .:|...:.|..|   |...   |.||:|:..|
  Fly    92 NDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRY 156

  Fly    63 VVTAAHCVKQGNNVAPAN---ELEIQAGSLLLSS-----GG------VRVPVATVTVHPNYNSN- 112
            ||||||||.........:   .:.::.|....|:     .|      |::.|..:.:|.::.:. 
  Fly   157 VVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRL 221

  Fly   113 -GHDVAVLRLRNSLTFNSNIAAIKLAT----EDPPNDATVDISGWG--AISQRGPISNSLLYVQV 170
             .:|:|::||...:.::.:|..:.|.:    ::..:.....::|||  ..|:..|:...|   :|
  Fly   222 FWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKL---RV 283

  Fly   171 KALSRESCQKTY--LRQLPETTMCLLHPKDKGACYGDSGGP--ATYQGKLV--GLASFVIGGCG- 228
            ..:....|::.|  :..|.::.:|........:|.||||||  |.::|..|  |:.||.: .|| 
  Fly   284 TYVEPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGL-NCGS 347

  Fly   229 RAAPDGYERVSKLRNWIAE 247
            |..|..|..|.....||.:
  Fly   348 RFWPAVYTNVLSYETWITQ 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 65/262 (25%)
Tryp_SPc 28..248 CDD:238113 67/265 (25%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 64/255 (25%)
Tryp_SPc 116..364 CDD:214473 62/251 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.