DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG9733

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:277 Identity:69/277 - (24%)
Similarity:112/277 - (40%) Gaps:73/277 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VEPRIVGGTKAREGQFPHQISL---RRRG---SHTCGGSIISKDYVVTAAHCVKQGNNVAPANEL 82
            :..||..|......:||..:.|   ||.|   |..|.||:|::.||:|||||:        ...:
  Fly   158 IRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCL--------TGRI 214

  Fly    83 EIQAGSLLL---------------SSGG------VRVPVATVTVHPNYNSNG----HDVAVLRLR 122
            |.:.|:|:.               ..||      .|:....:.||..|:...    ||:.::|:.
  Fly   215 EREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRME 279

  Fly   123 NSLTFNSNIAAIKLAT----EDPPNDATVDISGWG--------AISQRGPISNSLLYVQVKALSR 175
            .::.::.||..|.|.:    |...:.....::|||        |:.|:         |.|..:..
  Fly   280 RNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQK---------VTVNYVDP 335

  Fly   176 ESCQKTYLR---QLPETTMCLLHPKDKGACYGDSGGP-ATYQGK---LVGLASFVIGG--CG-RA 230
            ..|::.:.:   .|..|.:|......|.:|.|||||| ..::.:   |.|:.||   |  || :.
  Fly   336 AKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVSF---GYKCGLKD 397

  Fly   231 APDGYERVSKLRNWIAE 247
            .|..|..|:....||.:
  Fly   398 WPGVYTNVAAYDIWIRQ 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/270 (25%)
Tryp_SPc 28..248 CDD:238113 68/273 (25%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 67/270 (25%)
Tryp_SPc 162..415 CDD:238113 68/273 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.