DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and intr

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:218 Identity:44/218 - (20%)
Similarity:76/218 - (34%) Gaps:72/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG------------------SLLLSSGGVRVP 99
            |.|::||...|:|:|.|..:.....|....::||.                  :|||    :..|
  Fly   113 CSGALISTRLVLTSALCFPRTLRQPPPRSYKLQASRSRIYSVANLITGAIEDMALLL----LHAP 173

  Fly   100 VATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNS 164
            :....|||      .|:....||.    |.|:...                    :||:     .
  Fly   174 LEDPFVHP------IDLCESPLRR----NDNVTMY--------------------MSQQ-----H 203

  Fly   165 LLYVQVKALSRESCQKTYLRQ----LPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIG 225
            |.:::.|.:...:|:::|.:.    :.:|.:|.|:......|....|....:|.:|.|:..:   
  Fly   204 LRFLRTKLIPNSNCKRSYAQDENAFITQTMLCALNSNRLVDCQTAKGDVLLHQDRLCGVDIY--- 265

  Fly   226 GCGRAAPDG------YERVSKLR 242
              |:...||      |..|.|.|
  Fly   266 --GQHCSDGGVNGELYADVFKAR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 44/218 (20%)
Tryp_SPc 28..248 CDD:238113 44/218 (20%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 42/214 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.