DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG11836

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:243 Identity:75/243 - (30%)
Similarity:119/243 - (48%) Gaps:26/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG-- 87
            |.|||||......|:|....:...|...||||:::||||::||||||:    ...:::.:..|  
  Fly    94 EIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKK----LRKSKIRVIFGDH 154

  Fly    88 --SLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAIKLATED-PPNDATV 147
              .:...|..::..|..|..|.:::.:  .:|:|:||||..::|:..|..|.|...: .|.....
  Fly   155 DQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIG 219

  Fly   148 DISGWGAISQRGPISNSLLYVQVKALSRESC--QKTYLRQLPETTMCLLHPKDKGACYGDSGGPA 210
            .:.|||..|:.|.:.:.:..|:|..:|...|  |:....::..:.:|...| ...:|.||||||.
  Fly   220 TVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRP-SMDSCQGDSGGPL 283

  Fly   211 TYQGKLVGLASFVIG------GCGRAA-PDGYERVSKLRNWIAEKASL 251
            ....   |:..|::|      ||||.. |..|.||||...||  |::|
  Fly   284 LLSN---GVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI--KSNL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 70/233 (30%)
Tryp_SPc 28..248 CDD:238113 71/235 (30%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 72/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.