DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG5246

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:235 Identity:66/235 - (28%)
Similarity:115/235 - (48%) Gaps:22/235 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPRIVGGTKAREGQFPHQISLRRR-GSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGS 88
            |.|::||..:..|..|:|:|:... |.|.||||||:..:::|||||::.     |...|:|..|:
  Fly    39 ETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEW-----PIQYLKIVTGT 98

  Fly    89 LLLSSGGVRVPVATVTVH-----PNYNSNGHDVAVLRLRNSLTFNSNIAAIKLATED--PPNDAT 146
            :..:..|....|....:|     |.|:   :|:|::.....:.::.....||||::.  |.....
  Fly    99 VDYTRPGAEYLVDGSKIHCSHDKPAYH---NDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDK 160

  Fly   147 VDISGWGAISQRGPISNSLLYVQVKALSRESCQKTY--LRQLPETTMCLLHPKDKGACYGDSGGP 209
            :.::|||:....|..|..|..:.:..:..::||...  ...|.|..:|....:.:|:|:||||||
  Fly   161 LTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGP 225

  Fly   210 ATYQGK-LVGLASFVIG-GCGRAAPDGYERVSKLRNWIAE 247
            .....: |||:.::  | .|....||.:..|:...:||.:
  Fly   226 LVDANQTLVGVVNW--GEACAIGYPDVFGSVAYYHDWIEQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 63/229 (28%)
Tryp_SPc 28..248 CDD:238113 64/232 (28%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 63/229 (28%)
Tryp_SPc 42..263 CDD:238113 64/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.