DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG31266

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:240 Identity:73/240 - (30%)
Similarity:118/240 - (49%) Gaps:27/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSVVEPRIVGGTKAREGQFPHQISLRRRGS-HTCGGSIISKDYVVTAAHCVKQGNNVAPANELEI 84
            ::|.:.|::|||.|.||.:|...|::...| |.||..|:.:.:|:|||.||.   .:.|.|    
  Fly    45 EAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVA---GLRPLN---- 102

  Fly    85 QAGSLLLSSGGV-----RVPVATVT---VHPNYNS--NGHDVAVLRLRNSLTFNSNIAAIKLATE 139
                ||:.:|.|     ..|..||:   ||.|::.  ..:|:|:|:|.:.:.||.....|.||..
  Fly   103 ----LLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADI 163

  Fly   140 DPPNDA-TVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQ--LPETTMCLLHPKDKGA 201
            |...:. .:..:|||:....|.....|.......|..::|::....|  :....:|:.....:||
  Fly   164 DELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGA 228

  Fly   202 CYGDSGGP-ATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            |:||:||| ...|.:|||:.::.: .|||..||.|.|.:...:||
  Fly   229 CHGDTGGPLIDEQQRLVGIGNWGV-PCGRGYPDVYARTAFYHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 70/232 (30%)
Tryp_SPc 28..248 CDD:238113 71/233 (30%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 70/232 (30%)
Tryp_SPc 52..275 CDD:238113 71/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.