DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG17475

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:266 Identity:81/266 - (30%)
Similarity:116/266 - (43%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLR-RRGSHTCGGSIISKDYVVTAAH 68
            |.|.    |.||..||      |::.|...:.|:..:||||: ..|.|.|||.||.:.:|:||||
  Fly    37 WISK----AEGVNFQN------RVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAH 91

  Fly    69 CVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGH--DVAVLRLRNSLTFNSNI 131
            || .|.|   ...|.:..|::..........|....:|.||||..:  |:|::||.:::.||...
  Fly    92 CV-YGYN---PTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYT 152

  Fly   132 AAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETT------ 190
            ...:|.|....|...:.::|||:....|...:.|             ||.||..:..:|      
  Fly   153 QPAELPTAPVANGTQLLLTGWGSTELWGDTPDIL-------------QKAYLTHVVYSTCQEIMN 204

  Fly   191 ---------MCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGG--CGRAAPDGYERVSKLRNW 244
                     :|.|....:|||:||||||.|:.|.|.||.::   |  |....||.:..|.....|
  Fly   205 NDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNW---GYPCALGVPDSHANVYYYLEW 266

  Fly   245 IAEKAS 250
            |....|
  Fly   267 IRSMIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/237 (30%)
Tryp_SPc 28..248 CDD:238113 72/239 (30%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 71/237 (30%)
Tryp_SPc 50..269 CDD:238113 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.