DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG17477

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:236 Identity:83/236 - (35%)
Similarity:131/236 - (55%) Gaps:15/236 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VEPRIVGGTKAREGQFPHQISLRR-RGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG 87
            :|..||||..|.||..|:|:||:. .|||.|||:|||..:::||.||||.    .|.:.|::..|
  Fly    23 LEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKG----YPTSRLQVATG 83

  Fly    88 SLLLSS-GGVRVPVATVTVHPNYNSNGH--DVAVLRLRNSLTFNSNIAAIKLATEDPPNDAT-VD 148
            ::..:. |.|..|.| :.:|.||:|..:  |:.:|.|..|:|||:...|::|.|...|..|: :.
  Fly    84 TIRYAEPGAVYYPDA-IYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELV 147

  Fly   149 ISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLR----QLPETTMCLLHPKDKGACYGDSGGP 209
            .:|||:.|..|.:.:.|..||.:.|:..:|:.....    :|....:|.....:.|||:||||||
  Fly   148 FTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGP 212

  Fly   210 ATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKAS 250
            ..:||.|||:.:|.: .|.:..||.:..:...|:|:.:..|
  Fly   213 LVHQGTLVGILNFFV-PCAQGVPDIFMNIMYYRDWMRQTMS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 80/226 (35%)
Tryp_SPc 28..248 CDD:238113 81/228 (36%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 81/228 (36%)
Tryp_SPc 27..246 CDD:214473 80/224 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.