DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG14892

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:397 Identity:84/397 - (21%)
Similarity:121/397 - (30%) Gaps:166/397 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTSLLVLCAAGVLAQNDSVVE-----PRIVGGTKAREGQFPHQISLRRRG------SHTCGGSII 58
            |..||:|..:....:.|....     |||:.|....|||||.|.||....      .|.||..:|
  Fly    53 WLCLLLLLPSSRQFETDCGCRPARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLI 117

  Fly    59 SKDYVVTAAHCVKQG----------NNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNG 113
            .:.::::|||||...          ..|...::.::::|:      ..|:||..:.:|..|::..
  Fly   118 HQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRDVESGN------EQRIPVEKIVMHHRYHNFK 176

  Fly   114 HDVAVLRLRN--SLTFNSNIAAIKL-------------ATEDPPNDATVDI-------------- 149
            |||.:::|..  .||..|||..|.|             .|..||:.|..|:              
  Fly   177 HDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKI 241

  Fly   150 ----------------------------------------------------------------- 149
                                                                             
  Fly   242 DNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSD 306

  Fly   150 ------------------------SGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETT 190
                                    :|||..:..|.:||.||..||.......|:..|      .:
  Fly   307 DSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKTQVPLHQNGRCRDAY------GS 365

  Fly   191 MCLLH---------PKDKGACYGDSGGP----ATYQGK--LVGLASFVIGGCGRAAPDGYERVSK 240
            ...:|         ..:.|.|.||||||    .:..|.  |||:.||..|......||.|.|.|.
  Fly   366 FVNIHGGHLCAGKLNGEGGTCVGDSGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSY 430

  Fly   241 LRNWIAE 247
            ...||.:
  Fly   431 YMKWIED 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 76/366 (21%)
Tryp_SPc 28..248 CDD:238113 77/369 (21%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 76/366 (21%)
Tryp_SPc 81..438 CDD:238113 77/369 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.