DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG3505

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:110/268 - (41%) Gaps:78/268 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TKAREGQFPHQISLR-RRGS----HTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91
            |..|..:||....:. .||:    |.|||.:||..||:||||||.|    |..:.|:|.|     
  Fly   111 TDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQ----AATSNLQITA----- 166

  Fly    92 SSGGVRV------------------------PVATVTV-----HPNYNSNG----HDVAVLRLRN 123
                ||:                        |...:.:     ||.||...    :|:|::||.:
  Fly   167 ----VRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLAS 227

  Fly   124 SLTFNSNIAAIKLATE----DPPNDATVDISGWGAIS----QRGPISNSLLYVQVKALSRESCQK 180
            ....|..:..|.|..:    |...|...:::||.|.|    ::|       ||.:.::  |.||:
  Fly   228 PAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQASSSQRMRKG-------YVTISSI--EECQR 283

  Fly   181 TYLRQ---LPETTMCLLHPKDKGACYGDSGGPATY---QGKLV-GLASFVIGGCGRAA-PDGYER 237
            .|..|   :..:.:|.|  .:...|||::|||...   .|.|: ||.||....|.... ||.|.|
  Fly   284 KYASQQLRIQASKLCGL--TNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTR 346

  Fly   238 VSKLRNWI 245
            |:...:||
  Fly   347 VASYIDWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 73/266 (27%)
Tryp_SPc 28..248 CDD:238113 75/268 (28%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 75/268 (28%)
Tryp_SPc 111..354 CDD:214473 73/266 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.