DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG9649

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:257 Identity:66/257 - (25%)
Similarity:110/257 - (42%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AGVLAQNDSVVEPRIVGGTKAREGQFPHQISL----RRRGSHTCGGSIISKDYVVTAAHCVKQGN 74
            :|:..:...:..|.|..|.:...||.|...:|    .|..:..|||::||...|::||||.:.|:
  Fly   243 SGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGS 307

  Fly    75 NVAPANELEIQAG--SLLLSSGGVRVPVATVTVHPNYNSNGH---DVAVLRLRNSLTFNSNIAAI 134
            ...|.....:..|  ||.|.|.|..:.||.:.:|..||.|.:   |:|:|:|.|.:.....|..|
  Fly   308 RNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPI 372

  Fly   135 KLATE----DPPNDATVDISGWGAISQRGPISNSLL-YVQVKALSRESCQKTYLRQ----LPETT 190
            .|..|    :.|:.....::|||. .::|..:..|. ......:::..|:.....:    :...|
  Fly   373 CLWNENFLLELPSGHKSYVAGWGE-DEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHT 436

  Fly   191 MCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGG-------CGRAAPDGYERVSKLRNWI 245
            :|..:.:..|.|.|||||....|.:.:.:...|:..       |....|..|..|:|...|:
  Fly   437 ICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 63/242 (26%)
Tryp_SPc 28..248 CDD:238113 64/243 (26%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 63/241 (26%)
Tryp_SPc 259..497 CDD:214473 62/238 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12259
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.