DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG11670

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:280 Identity:77/280 - (27%)
Similarity:114/280 - (40%) Gaps:91/280 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SVVEPRIVGGTKAREGQFPHQISLRRRG-----SHTCGGSIISKDYVVTAAHC----------VK 71
            |:|.|          ||:||..:|..|.     .:.||||:||:::|:|||||          ||
  Fly   174 SIVAP----------GQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVK 228

  Fly    72 QGN--------NVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNS--NGHDVAVLRLRNSLT 126
            .|:        ||||.                 |..||.:.:||.||:  |.||:.:::|...:.
  Fly   229 IGDIKLKEWELNVAPQ-----------------RRRVAQIYLHPLYNASLNYHDIGLIQLNRPVE 276

  Fly   127 FNSNIAAIKLATEDPPND---ATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPE 188
            :...:..::|.   |.||   ..:...|:|:.....|.:|.|..:.:..:..|.|..:    ||.
  Fly   277 YTWFVRPVRLW---PMNDIPYGKLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSS----LPA 334

  Fly   189 ---------TTMCLLH--PKDKGACYGDSGGPAT---------------YQGKLVGLASFVIGG- 226
                     |:....|  .|::..|.||||||..               |:..|||:.|:  |. 
  Fly   335 DEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSY--GAY 397

  Fly   227 CGRAAPDGYERVSKLRNWIA 246
            |....|..|.|||...:|||
  Fly   398 CRSELPGVYTRVSSYIDWIA 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/272 (26%)
Tryp_SPc 28..248 CDD:238113 74/274 (27%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 77/280 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.