DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG12951

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:253 Identity:88/253 - (34%)
Similarity:135/253 - (53%) Gaps:19/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRR-RGSHTCGGSIISKDYVVTAAHCV 70
            ||:|:.|...:.|....:. |:|.||.:...::|..:|||. .|||:||||||||.:|:||||| 
  Fly    10 SLIVILAVTTVGQAAPSIS-RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHC- 72

  Fly    71 KQGNNVAPANELEIQAGSLLLSSGGVR-VPVATVTVHPNYN---SNGHDVAVLRLRNSLTFNS-N 130
               .|..||:.|.||.|...:|:.|.. |.:..:..|.:::   .|.:|:::|.:.....|:. :
  Fly    73 ---TNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVS 134

  Fly   131 IAAIK---LATEDPPNDATVD--ISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQL-PET 189
            :|.::   ||...|.:||.|:  :.|||.....|.:.::|..|.:|..|.|.|...:..|. |:.
  Fly   135 VAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKY 199

  Fly   190 TMC-LLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAA-PDGYERVSKLRNWI 245
            .:| .:....||.|.||||||..|.|:.||:.|:.|..|..|. |..|.:||:..:||
  Fly   200 HICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 81/231 (35%)
Tryp_SPc 28..248 CDD:238113 82/232 (35%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 81/231 (35%)
Tryp_SPc 30..260 CDD:238113 82/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.