DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Try10

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:259 Identity:77/259 - (29%)
Similarity:120/259 - (46%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK 71
            ::|:|...|......:..:.:||||...:|...|:|:|| ..|.|.||||:|::.:||:||||.|
  Rat     3 AVLILALVGAAVAFPAADDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINEQWVVSAAHCYK 66

  Fly    72 ---------QGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNY--NSNGHDVAVLRLRNSL 125
                     ...||...||..:.|              |.:..|||:  .:..:|:.:::|.:.:
  Rat    67 SRIQVRLGEHNINVLEGNEQFVNA--------------AKIIKHPNFIRKTLNNDIMLIKLSSPV 117

  Fly   126 TFNSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLY-VQVKALSRESCQKTYLRQLPET 189
            ..||.:|.:.|.:...|......|||||.....|.....||. :....|.:..|:.:|..::.:.
  Rat   118 KLNSRVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPGKITDN 182

  Fly   190 TMC---LLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDG---YERVSKLRNWIAE 247
            .:|   |...||  :|.||||||....|:|.|:.|:   |.|.|.||.   |.:|....:||.:
  Rat   183 MVCAGFLEGGKD--SCQGDSGGPVVCNGELQGIVSW---GYGCALPDNPGVYTKVCNYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 72/235 (31%)
Tryp_SPc 28..248 CDD:238113 74/238 (31%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 72/235 (31%)
Tryp_SPc 24..242 CDD:238113 74/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.