DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:281 Identity:79/281 - (28%)
Similarity:134/281 - (47%) Gaps:40/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWTSLLVLCAAGVLAQNDSVVEP------------------RIVGGTKAREGQFPHQISLRRRGS 50
            ||.|:..:....:.:|...:::.                  ::.||..|.||::|.|.||::...
  Rat   145 FWDSVETILYQKLKSQTRLLIDSSSFKFSGCGRRTITPGGHKVAGGQDAEEGEWPWQASLQQNNV 209

  Fly    51 HTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGH- 114
            |.||.::||..:::|||||..:..|   ..:.::..| .|||....:..|.::.:|.||:...| 
  Rat   210 HRCGATLISNSWLITAAHCFVRSAN---PKDWKVSFG-FLLSKPQAQRAVKSIVIHENYSYPAHN 270

  Fly   115 -DVAVLRLRNSLTFNSNI--AAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRE 176
             |:||:||.:.:.:.:||  |.:..||:..|.::.|.::|||.:...|...|.|...:||.:..:
  Rat   271 NDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGRVKIIDNK 335

  Fly   177 SCQ--KTYLRQLPETTMCLLHPKDK-GACYGDSGGPATYQGK-----LVGLASFVIGGCGRAAPD 233
            :|.  |.|...:....:|....:.: .||.||||||...:..     |.|:.|:   |...|.|:
  Rat   336 TCNSGKAYGGVITPGMLCAGFLEGRVDACQGDSGGPLVSEDSKGIWFLAGIVSW---GDECALPN 397

  Fly   234 G---YERVSKLRNWIAEKASL 251
            .   |.||:..|:||:.|..|
  Rat   398 KPGVYTRVTHYRDWISSKTGL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/232 (31%)
Tryp_SPc 28..248 CDD:238113 73/234 (31%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699 3/11 (27%)
Tryp_SPc 186..412 CDD:214473 71/232 (31%)
Tryp_SPc 187..415 CDD:238113 73/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.