DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG10587

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:258 Identity:71/258 - (27%)
Similarity:114/258 - (44%) Gaps:56/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LCAAGVLAQ--NDSV-------------VEPRIVGG---TKAREGQFPHQISLRRRGSHTCGGSI 57
            |.:..||||  |.::             .:.|:|||   |.|:.|.:  .|:||...:..|||::
  Fly    14 LASIEVLAQDLNQTIDVNKLAKIVQRPGFQTRVVGGDVTTNAQLGGY--LIALRYEMNFVCGGTL 76

  Fly    58 ISKDYVVTAAHC----VKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDV 116
            :....|:|||||    ||..:.:|       ..|:..|:..|::..|..|.....:..:  ..||
  Fly    77 LHDLIVLTAAHCFLGRVKISDWLA-------VGGASKLNDRGIQRQVKEVIKSAEFREDDMNMDV 134

  Fly   117 AVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWGAI--SQRGPISNSLLYVQVKALSRESCQ 179
            |:|||:..:. ..::..:.|..:.......:.:||||..  |:.|| ...|..|.|..:.::.|:
  Fly   135 AILRLKKPMK-GKSLGQLILCKKQLMPGTELRVSGWGLTENSEFGP-QKLLRTVTVPVVDKKKCR 197

  Fly   180 KTYLR---------------QLPETTMC--LLHPKDKGACYGDSGGPATYQGKLVGLASFVIG 225
            .:||.               .|.::..|  :|..||  ||..|||||..|:.::.|:.||.||
  Fly   198 ASYLPTDWESHKHFDLFLKVHLTDSMFCAGVLGKKD--ACTFDSGGPLVYKNQVCGIVSFGIG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 65/227 (29%)
Tryp_SPc 28..248 CDD:238113 64/226 (28%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 65/227 (29%)
Tryp_SPc 46..280 CDD:238113 64/226 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.