DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG11037

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:237 Identity:67/237 - (28%)
Similarity:115/237 - (48%) Gaps:23/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPRIVGG---TKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHC----VKQGNNVAPANEL 82
            |.|::||   |.|:.|.:  ..:|.......|||::::::.|:|||||    :|       |:|.
  Fly    59 ETRVIGGHVTTNAKLGGY--LTALLYEDDFVCGGTLLNENIVLTAAHCFLGRMK-------ASEW 114

  Fly    83 EIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDA 145
            .:.||...|:..|:|..|....:...:..:  ..||||:.|:..|. ..||..:.|.:.......
  Fly   115 IVAAGISNLNQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLK-AKNIGTLSLCSVSLKPGV 178

  Fly   146 TVDISGWGAISQRGPISNSLL-YVQVKALSRESCQKTY--LRQLPETTMCLLHPKDKGACYGDSG 207
            .:.:||||..:.||...::|| .|.|..:.:::|:..|  ..::.::.:|......|.||..|||
  Fly   179 ELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVLGRKDACTFDSG 243

  Fly   208 GPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKA 249
            ||..::.::.|:.||.||......|..|..|..::.:| ||:
  Fly   244 GPLVFKKQVCGIVSFGIGCASNRYPGVYTDVMYVKPFI-EKS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 63/229 (28%)
Tryp_SPc 28..248 CDD:238113 63/231 (27%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 63/229 (28%)
Tryp_SPc 62..283 CDD:238113 63/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.