DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG7542

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:260 Identity:79/260 - (30%)
Similarity:117/260 - (45%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLR---RRGSHTCGGSIISKDYVVTAAHC 69
            |||.....|....|  |||.|..|..|..||||:|..|.   ...|..|||::||..:::|||||
  Fly     9 LLVGSCTAVPLLTD--VEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHC 71

  Fly    70 VKQGNNVAPANELEIQAGSLLL----SSGGVRVPV--ATVTVHPNYNSNG--HDVAVLRLRNSLT 126
            :....:|.      :..|::.:    ..|..|:.|  :.:.||.||.::.  :|::::||...:.
  Fly    72 MDGAESVT------VYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVG 130

  Fly   127 FNSNIAAIKLATEDPPNDATVD-----ISGWGAISQRG-PISNSLLYVQVKALSRESCQKTYLRQ 185
            |...|.|..|.........|.:     .||||..|... .:|..|.||::..:....|:..:...
  Fly   131 FTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGA 195

  Fly   186 LPETTMCLLHPKDKGACYGDSGGPATY-QGK---LVGLASFVIG-GCGRAAPDGYERVSKLRNWI 245
            :.|..:|:.....|..|:||||||..| ||.   |:|..||... ||....|..:.|:|...:||
  Fly   196 VSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260

  Fly   246  245
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/239 (29%)
Tryp_SPc 28..248 CDD:238113 71/240 (30%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 71/240 (30%)
Tryp_SPc 27..260 CDD:214473 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.