DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG4914

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:276 Identity:79/276 - (28%)
Similarity:116/276 - (42%) Gaps:54/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCV 70
            ||....|..|  .:||   |.||||||.....::|....|.......|||::|:..||:||||||
  Fly   111 TSPTCSCRCG--ERND---ESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCV 170

  Fly    71 KQ----------------GNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGHDVAVL 119
            |.                .:...|.....::|.|...|                :::..:|:|:|
  Fly   171 KGFMWFMIKVTFGEHDRCNDKERPETRFVLRAFSQKFS----------------FSNFDNDIALL 219

  Fly   120 RLRNSLTFNSNIAAIKLATEDPPNDATVD----ISGWGAISQRGPISNSLLYVQVKALSRESC-- 178
            ||.:.:...|.|..|.|...:...|..|.    .:|||.:.:.|..|..|..|:|..|..:.|  
  Fly   220 RLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVA 284

  Fly   179 QKTYL-RQLPETTMCLLHPKDKG--ACYGDSGGPAT------YQGKLVGLASFVIGGCGRA-APD 233
            |..|. :.:.:..||..:|...|  :|.||||||..      .:.:.:|:.|:. .||.|. .|.
  Fly   285 QTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWG-NGCARPNYPG 348

  Fly   234 GYERVSKLRNWIAEKA 249
            .|.||:|..:||.|.:
  Fly   349 VYTRVTKYLDWIVENS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/249 (28%)
Tryp_SPc 28..248 CDD:238113 70/251 (28%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 69/249 (28%)
Tryp_SPc 128..363 CDD:238113 70/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.