DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG4613

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:253 Identity:85/253 - (33%)
Similarity:116/253 - (45%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCV----KQ 72
            |..||...|      ||||||:.|..::|....:.|.....|||::|:..||:||||||    .:
  Fly   127 CTCGVPNVN------RIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMR 185

  Fly    73 GNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIK 135
            |.:|   ..|::...|..|   ||...||....|..|:  |..||:|:|||...:.....:....
  Fly   186 GVSV---RLLQLDRSSTHL---GVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPAC 244

  Fly   136 LATEDPPN------DATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKT-YLRQLPETTMCL 193
            |    |.|      .....::|||...:.|..|:.|..|.|..::...|:.| |...:.:|.||.
  Fly   245 L----PSNWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCA 305

  Fly   194 LHPKDKG--ACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDG---YERVSKLRNWIA 246
            .:.|..|  ||.||||||...:.::..||..|..|.|.|.||.   |.|||:...|||
  Fly   306 GYVKTGGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIA 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 78/235 (33%)
Tryp_SPc 28..248 CDD:238113 80/237 (34%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 78/235 (33%)
Tryp_SPc 137..362 CDD:238113 77/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.