DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG10663

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:272 Identity:71/272 - (26%)
Similarity:121/272 - (44%) Gaps:45/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PFWTSLLVLC-----AAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHT-CGGSIISKD 61
            |.:|.|.:.|     ..|..:.::.:   :|:||..||:|::|.|:::..|.... |||::|:..
  Fly   480 PEYTPLKLSCGIVRSGTGRRSMSNML---KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPR 541

  Fly    62 YVVTAAHCVKQ-------GNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVA 117
            :|:||||||::       .:|:...:..|||            :.|.....|||::..  ..|||
  Fly   542 WVLTAAHCVRKVLFVRIGEHNLNYEDGTEIQ------------LRVMKSYTHPNFDKRTVDSDVA 594

  Fly   118 VLRLRNSLTFNSNI--AAIKLATEDPPNDATVDISGWGAISQRGPISNSLLY-VQVKALSRESCQ 179
            :|||..::...:.|  :.:....:..|.:....|.|||....|.....|:|: ..|..:..::|:
  Fly   595 LLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCR 659

  Fly   180 KTYL-RQLPETTMCLLHPKDK-GACYGDSGGP--------ATYQGKLVGLASFVIGGCGRAAPDG 234
            |.|. ..:.:...|..|.|.. ..|.||||||        ..:...:.|:.||. .||.:....|
  Fly   660 KVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFG-DGCAQRNKFG 723

  Fly   235 -YERVSKLRNWI 245
             |.:|....:|:
  Fly   724 IYAKVPNYVDWV 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 65/241 (27%)
Tryp_SPc 28..248 CDD:238113 66/242 (27%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 65/241 (27%)
Tryp_SPc 507..735 CDD:238113 65/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.