DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG32374

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:235 Identity:70/235 - (29%)
Similarity:106/235 - (45%) Gaps:23/235 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91
            |||.|.|.:..:.|:|.:|.......||..|:::.:::||.|| |.||    .....::|||...
  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC-KIGN----PGRYTVRAGSTQQ 132

  Fly    92 SSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDI----- 149
            ..||....|.....||||:  :..:|:.:::|:..|.....:..:||     |:..|...     
  Fly   133 RRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKL-----PSTRTKRFPKCYL 192

  Fly   150 -SGWGAISQRGP-ISNSLLYVQVKALSRESCQKTYLR---QLPETTMCLLHPKDKGACYGDSGGP 209
             ||||..|.... :...|..|.|..:||..||:.|..   ::.:..:|... |::..|.||||||
  Fly   193 ASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKR-KNRDTCSGDSGGP 256

  Fly   210 ATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKA 249
            ..:.|.|.|:.||.||......|..|..|.:...||.:.|
  Fly   257 LVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKVA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/229 (29%)
Tryp_SPc 28..248 CDD:238113 68/231 (29%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 67/229 (29%)
Tryp_SPc 74..295 CDD:238113 68/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.