DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG16998

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:257 Identity:76/257 - (29%)
Similarity:122/257 - (47%) Gaps:41/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSVVEP--RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCV 70
            ||::|     ....|.:.|  |||||.:......|...|:...|:::|..::|:..::|||.|||
  Fly     8 LLLIC-----GHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV 67

  Fly    71 KQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAA 133
            :..::.:      ::|||.....||.|..|.:|.:||::|  :..:|:|:|:|..|.|...||..
  Fly    68 QYPDSYS------VRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQV 126

  Fly   134 IKLATEDPPN----DATVDISGWG----AISQRGPISNSLLYVQVKALSRESCQKTYL---RQLP 187
            :||..   |:    ..|:.::|||    ..|:..|   .|....||.:::..||:.|.   |.:.
  Fly   127 VKLPL---PSLNILPRTLLVAGWGNPDATDSESEP---RLRGTVVKVINQRLCQRLYSHLHRPIT 185

  Fly   188 ETTMCLLHPKDKGA----CYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            :..:|.     .||    ||||||.|..::|...|:.||..|......|..|.|::....||
  Fly   186 DDMVCA-----AGAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/234 (29%)
Tryp_SPc 28..248 CDD:238113 70/235 (30%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 69/234 (29%)
Tryp_SPc 25..242 CDD:238113 68/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.