DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG10469

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:251 Identity:75/251 - (29%)
Similarity:115/251 - (45%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISL------RRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQ 85
            ||:.||.|:..|.|:|:.|      .:...:.|||:|:|..:::|||||::.     |.:.|   
  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQD-----PKSNL--- 79

  Fly    86 AGSLLLSSGGVR--------VPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAIKLATED 140
             ..:|:..|.|:        |..:...||..::..  .:|:|:::|...||||..|...||    
  Fly    80 -WKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKL---- 139

  Fly   141 PPNDATVD-----ISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLH----- 195
            |....|..     |||||..:::.| |..|.|::...:|.:.|::.:.:||...:..::|     
  Fly   140 PSAKKTYTGRKAIISGWGLTTKQLP-SQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFIC 203

  Fly   196 -PKDKG-ACYGDSGGPATYQG---KLVGLASFVIGG-CGRAAPDGYERVSKLRNWI 245
             ...|| .|.||||||.....   .|||:.|....| |....||...|||....||
  Fly   204 IDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 73/249 (29%)
Tryp_SPc 28..248 CDD:238113 74/250 (30%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 73/249 (29%)
Tryp_SPc 24..260 CDD:238113 74/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.