DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG6462

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:253 Identity:74/253 - (29%)
Similarity:117/253 - (46%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SVVEPRIVGGTKAREGQFPHQISL--RRRGSH--TCGGSIISKDYVVTAAHCVKQGNNVAPANEL 82
            :.|..||.||..|..|.||:|:.|  :..|:.  .||||:|:..:|:|||||      :..|...
  Fly    71 AAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHC------LTDAIAA 129

  Fly    83 EIQAGSLLLSSGGVRVPVATVT-----VHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKLATED 140
            :|..|:.:.:.....|....||     ::|:|...|  .|:|::||...:..:..:..|:||.|.
  Fly   130 KIYTGATVFADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEF 194

  Fly   141 PPND----ATVDISGWGAISQRGPISNSLL-YVQVKALSRESCQKTYLRQL--PETTMCLLHPKD 198
            ...:    ..|.:||||.:.........|| |:..:.:.:|.|...:|..|  ....:|......
  Fly   195 MHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNG 259

  Fly   199 KGACYGDSGGPATYQGK----LVGLASF-VIGGCGRAAPDGYERVSKLRNWIAEKASL 251
            :|||.||||||..|..:    |:|:.|| ...||....|..|.|::....||.::.::
  Fly   260 RGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAM 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/240 (30%)
Tryp_SPc 28..248 CDD:238113 72/242 (30%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 71/240 (30%)
Tryp_SPc 77..314 CDD:238113 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.