DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG10477

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:273 Identity:86/273 - (31%)
Similarity:136/273 - (49%) Gaps:35/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLA---QNDSVVEP-----------RIVGGTKAREGQFPHQISLRRR---GSHTCG 54
            ::|||..|.|.|   :.|:.|.|           ||..|.||...|||:|:.|..:   ||..||
  Fly     5 AVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCG 69

  Fly    55 GSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVAT--VTVHPNYNSN--GHD 115
            ||||:..:|:|||||.|..::|.      |..||.:.:|..::..|::  ...|..||:.  .:|
  Fly    70 GSIIANTWVLTAAHCTKGASSVT------IYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRND 128

  Fly   116 VAVLRLRNSLTFNSNIAAIKL----ATEDPPNDATVDISGWGAISQRG-PISNSLLYVQVKALSR 175
            ::::: ..|:||..:|..|.|    ::.......|...||||..|... .::.:|.|.|.:.::.
  Fly   129 ISLIK-TPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITN 192

  Fly   176 ESCQKTYLRQLPET-TMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIG-GCGRAAPDGYERV 238
            ..||||:...:..: .:|:.....|..|.||||||.....:|:|:.|||.. ||.:.||.|:.||
  Fly   193 AVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNNRLIGVTSFVSSKGCEKNAPAGFTRV 257

  Fly   239 SKLRNWIAEKASL 251
            :...:||..::.:
  Fly   258 TSYLDWIKNQSGV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 75/231 (32%)
Tryp_SPc 28..248 CDD:238113 76/233 (33%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 75/231 (32%)
Tryp_SPc 40..267 CDD:238113 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.