DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG14990

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:316 Identity:85/316 - (26%)
Similarity:123/316 - (38%) Gaps:86/316 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPFW---TSLLV--LCAAGVLAQNDSVVEPRIVGGTKARE------------------------ 36
            ||..|   |.|||  ||:|  ..||:... |.|..|....|                        
  Fly     1 MLKNWTINTFLLVSFLCSA--TGQNEGGA-PGIFNGMSFTENLQPDPNQVCGMSNPNGLVANVKV 62

  Fly    37 -------GQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSG 94
                   ||||..::|..:|.:...||:|:.:.|:|||..| .|...|   |:.::||..   :.
  Fly    63 PKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIV-VGKTDA---EIVVRAGEW---NT 120

  Fly    95 GVRV--------PVATVTVHP--NYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVD- 148
            |.|.        |||.|..|.  :|....:::|:|.|.|.....|:|..|.|    |....:.| 
  Fly   121 GQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICL----PSQGRSFDQ 181

  Fly   149 ----ISGWGAISQRGP-ISNSLLYVQVKALSRESCQKTYLR--------QLPETTMCLLHPKDKG 200
                ::|||.::.... .||....:::..::|..|| ..||        .||.:.:|....||.|
  Fly   182 KRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQ-DQLRNTRLGVSFDLPASLICAGGEKDAG 245

  Fly   201 ACYGDSGG---------PATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247
            .|.||.|.         |:.|:  ..|:.::.||......|..|..|...|:||.|
  Fly   246 DCLGDGGSALFCPMEADPSRYE--QAGIVNWGIGCQEENVPAVYTNVEMFRDWIYE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/281 (25%)
Tryp_SPc 28..248 CDD:238113 72/284 (25%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 69/247 (28%)
Tryp_SPc 67..297 CDD:214473 66/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.