DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG13430

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:258 Identity:86/258 - (33%)
Similarity:129/258 - (50%) Gaps:24/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQNDSVVEP--RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHC 69
            :|.::|.:.  |||.:.||.  |||||.:.....||||:||:....|.|||:|||.:.::|||||
  Fly    11 ALWLICTSA--AQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHC 73

  Fly    70 VKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNS---NGHDVAVLRLRNSLTFNSNI 131
            |.:   .:......|:|||...:.||..:.|..:..||.::.   ..:|:|:::|:..|.::.:|
  Fly    74 VLE---YSKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDI 135

  Fly   132 AAIKLATEDP---PNDATVDISGWG--AISQRGPISNSLLYVQVKALSRESCQKTYL--RQLPET 189
            ..|.|||...   |. |.:.:||||  :|||..| ...|.|..|....:..|.:.|.  ..:..|
  Fly   136 RPISLATSKDIIMPT-AQLFVSGWGSTSISQMQP-EKRLRYTVVHLRDQNQCARNYFGAGTVTNT 198

  Fly   190 TMCL-LHPKDKGACYGDSGGP--ATYQG--KLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247
            ..|. .....:.:|.||||||  .:..|  ||.|:.|:..|......|..|.:||...:|||:
  Fly   199 MFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 76/232 (33%)
Tryp_SPc 28..248 CDD:238113 78/235 (33%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 76/232 (33%)
Tryp_SPc 32..262 CDD:238113 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.