DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG32269

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:234 Identity:84/234 - (35%)
Similarity:124/234 - (52%) Gaps:15/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANEL 82
            |...|.::.||||||.......|:.:.| ||||:.|.||:|::.:|:|||||||..:    |::.
  Fly    99 AATSSKIQSRIVGGTSTTISTTPYIVQL-RRGSNLCSGSLITEQWVLTAAHCVKGYS----ASDF 158

  Fly    83 EIQAGSLLL-SSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAIKLATEDPPND 144
            .::.|:..| .|.||...|:::.|.|.:.|.  ..|.|:|:|..||| .:||..|.:....|...
  Fly   159 TVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLT-GTNIGTISMGNYRPKAG 222

  Fly   145 ATVDISGWGAISQRG--PISNSLLYVQVKALSRESCQKTYLRQLPETT-MCLLHPKDKGACYGDS 206
            :.|.|:||| :::.|  ..|.:|...|::.:.::.|:|.|..|...|. |.......|.:|.|||
  Fly   223 SRVRIAGWG-VTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAGKDSCSGDS 286

  Fly   207 GGPATYQGKLVGLASFVIGGCGRAA-PDGYERVSKLRNW 244
            |||.|....|:|:.||.. ||.||. |..|..|..:|.|
  Fly   287 GGPVTRNNTLLGIVSFGY-GCARAGYPGVYTAVVAIRQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 82/225 (36%)
Tryp_SPc 28..248 CDD:238113 81/224 (36%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 81/223 (36%)
Tryp_SPc 121..324 CDD:238113 75/210 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.