DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG32270

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:270 Identity:90/270 - (33%)
Similarity:129/270 - (47%) Gaps:44/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLP--FWTSLLVLCAAGVLAQNDSVVE-------PRIVGGTKAREGQFPHQISLRRRGSHTCGGS 56
            :||  ||          :|...:||.|       ||||||..:.....||.:::||||:..||||
  Fly     5 LLPLMFW----------MLWIRESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGS 59

  Fly    57 IISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVL 119
            :::...|:|||||:..||    .::..::.|...||.......|..:.:...|:..  .||||:|
  Fly    60 LVTPRCVLTAAHCLNDGN----PSDFVVRGGVTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALL 120

  Fly   120 RLRNSLTFNSNIA-AIKLATEDPPNDATVDISGWGAI-SQRGPISNSLLYVQVKALSRESCQKTY 182
            :|:..|  .::|| .|.||...|...:.|.:||||.. |....:.|.|..|.|:.:.:..|:..|
  Fly   121 QLKQPL--QASIAKPISLAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLY 183

  Fly   183 --LRQLPETTMCLLHPKDKGACYGDSGGP-ATYQGKLVGLASFVIGGCGRA-------APDGYER 237
              .|.:..:..|...|..|.||.|||||| ....|.|||:.|:     |||       :|..|..
  Fly   184 RGYRNITSSMFCASVPGLKDACAGDSGGPVVNSNGILVGVVSW-----GRAHRCAARDSPGVYSD 243

  Fly   238 VSKLRNWIAE 247
            ||.|.:|||:
  Fly   244 VSYLSDWIAD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 78/231 (34%)
Tryp_SPc 28..248 CDD:238113 80/234 (34%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 78/231 (34%)
Tryp_SPc 31..254 CDD:238113 80/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.