DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and tpr

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:262 Identity:70/262 - (26%)
Similarity:125/262 - (47%) Gaps:51/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCV------ 70
            |..|:     :.::.|||||.:....|:|....|...|...|..|:::..:::||:|||      
  Fly   116 CVCGI-----ANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKE 175

  Fly    71 -------KQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGH--DVAVLRLRNSLT 126
                   :....::...:::.:              ||.|..||.||:..:  |:|:::|...:.
  Fly   176 RISVRLLEHDRKMSHMQKIDRK--------------VAEVITHPKYNARNYDNDIAIIKLDEPVE 226

  Fly   127 FNSNIAAIKLATEDPPNDATVD---ISGWGAISQRGPISNSLLYVQVKALSRESCQKT-YLRQLP 187
            ||..:..:.:.|  |......:   ::||||:...||.|::|..|||..||::.|:|: |..::.
  Fly   227 FNEVLHPVCMPT--PGRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKIT 289

  Fly   188 ETTMCLLHPK-DKGACYGDSGGP------ATYQGKLVGLASFVIG-GCGRAA-PDGYERVSKLRN 243
            :..:|..:.: .|.:|.||||||      .|.:.::.|:.|:  | ||.:|. |..|.||::...
  Fly   290 DNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSW--GEGCAKAGYPGVYARVNRYGT 352

  Fly   244 WI 245
            ||
  Fly   353 WI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 66/245 (27%)
Tryp_SPc 28..248 CDD:238113 67/246 (27%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 66/245 (27%)
Tryp_SPc 127..356 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.