DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG11192

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:263 Identity:89/263 - (33%)
Similarity:131/263 - (49%) Gaps:26/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAH 68
            :|...||..|.......|.    |||||..|...:||:|:|::.:|.|.|||:||..|.|:||||
  Fly     8 WWLMALVAYAGATPTPGDG----RIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAH 68

  Fly    69 CVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGH--DVAVLRLRNSLTFNSNI 131
            |.:...:.|   :..::.||....|||..:.:..|..|.:||...|  |:|:|.|...|.|..::
  Fly    69 CFEDPWSSA---DYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHL 130

  Fly   132 AAIKLAT-EDPPN-DATVDISGWG------AISQRGPISNSLLYVQVKALSRESCQKTYLRQLPE 188
            ..:.||. .|||. |..:.:||||      |:|....:|..|.:|.|..:....|::.|.:.||.
  Fly   131 QPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPI 195

  Fly   189 T--TMCLLHPKDKGACYGDSGGP----ATYQG--KLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            |  .:|...| .:.:|.||||||    |..:|  :|.|:.|:.:|......|..|..|:..|:||
  Fly   196 TRRMICAARP-GRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259

  Fly   246 AEK 248
            .|:
  Fly   260 DEQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 81/235 (34%)
Tryp_SPc 28..248 CDD:238113 82/237 (35%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 81/235 (34%)
Tryp_SPc 28..262 CDD:238113 82/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.