DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss48

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:244 Identity:77/244 - (31%)
Similarity:125/244 - (51%) Gaps:34/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSL-- 89
            |||||..|..|::|.|:|||...:|:||||:||..:|:|||||:|:   ...:....:..||:  
Mouse    39 RIVGGQDAALGRWPWQVSLRFDYTHSCGGSLISDHWVLTAAHCIKK---TWYSFLYSVWLGSIDR 100

  Fly    90 LLSSGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPN-------DATV 147
            ..||.|....|:.:.:...:.....|:|:|:|.:.:||:|.|..|.|     ||       .|:.
Mouse   101 EYSSTGKEYYVSRIAIPDKHRHTEADIALLKLSSRVTFSSVILPICL-----PNISKQLTVPASC 160

  Fly   148 DISGWGAISQRGPISNSLLYVQVKALSRESCQKTY----------LRQLPETTMCLLHPKD-KGA 201
            .::|||. :|.|...::|..::|..:|.|:|::.|          .|.:.|...|....:. |.:
Mouse   161 WVTGWGQ-NQEGHYPSTLQELEVPVISSEACEQLYNPIGVFLPDLERVIKEDMFCAGERQSRKDS 224

  Fly   202 CYGDSGGPATYQ----GKLVGLASFVIGGCGRAAPDGYERVSKLRNWIA 246
            |.||||||.:..    .:|:|:.|:.: .||:..|..|..|:..:.||:
Mouse   225 CKGDSGGPLSCHIDGVWRLMGVVSWGL-ECGKDLPGVYTNVTYYQKWIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 75/241 (31%)
Tryp_SPc 28..248 CDD:238113 76/243 (31%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 75/241 (31%)
Tryp_SPc 40..274 CDD:238113 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12259
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.