DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG8299

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:257 Identity:86/257 - (33%)
Similarity:135/257 - (52%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSV-VEPRIVGGTKAREGQFPHQISLRRRG---SHTCGGSIISKDYVVTAAH 68
            |.:|.|.||:...||. :...||||.:|....||:|:|:|...   .|.|||||.:...|:||||
  Fly     7 LFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAH 71

  Fly    69 CVKQGNNVAPANELEIQAG--SLL-LSSGGVRVPVATVTVHPNYNSNGH--DVAVLRLRNSLTFN 128
            |:| |..   |:.:.|.||  |:. |...||:  |:.:..|..||...:  |:.::..|..|.::
  Fly    72 CIK-GRY---ASYIRIVAGQNSIADLEEQGVK--VSKLIPHAGYNKKTYVNDIGLIITREPLEYS 130

  Fly   129 SNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLL-YVQVKALSRESCQKTYLRQ---LPET 189
            :.:..|.:|.|.||:.|...:||||..::......::| .|:::.:.:.:|...||.:   :.:.
  Fly   131 ALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDE 195

  Fly   190 TMCLLHPK-DKGACYGDSGGPATYQGKLVGLASFVIGGCGRAA-PDGYERVSKLRNWIAEKA 249
            .:|..:.: .|..|.||||||....|.|||:.|:.: ||||.. |..|..|:...:||.|:|
  Fly   196 MLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGV-GCGREGFPGVYTSVNSHIDWIEEQA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 75/231 (32%)
Tryp_SPc 28..248 CDD:238113 77/233 (33%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 75/231 (32%)
Tryp_SPc 28..255 CDD:238113 77/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.