DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Ctrc

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:246 Identity:72/246 - (29%)
Similarity:112/246 - (45%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLR----RRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG 87
            |:|||..|....:|.|:||:    ....||||||:|:..:|:|||||:.:...      ..:..|
  Rat    29 RVVGGEDAVPNSWPWQVSLQYLKDDTWRHTCGGSLITTSHVLTAAHCINKDFT------YRVGLG 87

  Fly    88 SLLLS----SGGVRVPVATVTVHPNYNS--NGHDVAVLRLRNSLTFNSNIAAIKLATEDP--PND 144
            ...|:    .|.|...|.|:.||..:|.  ..:|:|:::|...:..::.|....:..|..  |.|
  Rat    88 KYNLTVEDEEGSVYAEVDTIYVHEKWNRLFLWNDIAIIKLAEPVELSNTIQVACIPEEGSLLPQD 152

  Fly   145 ATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKT--YLRQLPETTMCLLHPKDKGACYGDSG 207
            ....::|||.:...|||:..|.......:|..:|.:.  :..::.:|.:|........||.||||
  Rat   153 YPCYVTGWGRLWTNGPIAEVLQQGLQPIVSHATCSRLDWWFIKVRKTMVCAGGDGVISACNGDSG 217

  Fly   208 GPATYQG-----KLVGLASF-VIGGCG-RAAPDGYERVSKLRNWIAEKASL 251
            ||...|.     ::.|:.|| ...||. ...|..:.|||...:||.||..|
  Rat   218 GPLNCQAEDGSWQVHGIVSFGSSSGCNVHKKPVVFTRVSAYNDWINEKIQL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/238 (28%)
Tryp_SPc 28..248 CDD:238113 68/240 (28%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 67/238 (28%)
Tryp_SPc 30..265 CDD:238113 68/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.