DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss3

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:248 Identity:72/248 - (29%)
Similarity:118/248 - (47%) Gaps:16/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK 71
            :||.|...||........:.:||||...:|...|:|:|| ..|.|.||||:|:..:||:||||.|
  Rat     3 ALLFLALVGVAVAFPVDDDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHCYK 66

  Fly    72 QGNNVAPANELEIQAGS---LLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNI 131
                    ..::::.|.   .:|......|..|.:..|||:|:.  .:|:.:::|.:.:..|:.:
  Rat    67 --------TRIQVRLGEHNINVLEGDEQFVNAAKIIKHPNFNARNLNNDIMLIKLSSPVKLNARV 123

  Fly   132 AAIKLATEDPPNDATVDISGWGAISQRGPISNSLLY-VQVKALSRESCQKTYLRQLPETTMCL-L 194
            |.:.|.:...|......|||||.....|..:..||. :....|.:..|:.:|..::....:|: .
  Rat   124 ATVALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPGKITNNMICVGF 188

  Fly   195 HPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247
            ....|.:|.||||||....|:|.|:.|:..|...:..|..|.:|....:||.:
  Rat   189 LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 65/224 (29%)
Tryp_SPc 28..248 CDD:238113 67/227 (30%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 65/224 (29%)
Tryp_SPc 24..242 CDD:238113 67/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.