DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and thetaTry

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:244 Identity:87/244 - (35%)
Similarity:126/244 - (51%) Gaps:15/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CAAGVLAQNDSVV--EPRIVGGTKAREGQFPHQISLR-RRGSHTCGGSIISKDYVVTAAHCVKQG 73
            ||..|...|....  |.|||||.....|..|:|:||: :.|||.||||:|::|.|||||||: .|
  Fly    17 CAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCL-VG 80

  Fly    74 NNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAIKL 136
            ..|   :::.::.||.|.:.||:.|.|..:..:.:|||.  .:||.:|:|...:....||..|:|
  Fly    81 RKV---SKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIEL 142

  Fly   137 ATEDPPNDATVDISGWGAISQRG--PISNSLLYVQVKALSRESC---QKTYLRQLPETTMCLLHP 196
            |||.||...|..::|||:.....  .:..:|..|.|..:..::|   :..|...:.::.:| .:.
  Fly   143 ATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVC-AYE 206

  Fly   197 KDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            |.|.||.||||||......|||:.|:.........|..|..|..||.||
  Fly   207 KKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 80/225 (36%)
Tryp_SPc 28..248 CDD:238113 81/226 (36%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 80/225 (36%)
Tryp_SPc 35..255 CDD:238113 79/224 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.