DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG8172

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:248 Identity:76/248 - (30%)
Similarity:121/248 - (48%) Gaps:39/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHT----CGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG 87
            |||||.....|..|.|::|.:.|..|    |||::||..:|:||||||..    .|.:.::|:.|
  Fly   315 RIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVAS----TPNSNMKIRLG 375

  Fly    88 SLLLSSGGVRV-----PVATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKLATEDPPNDA 145
            ...:.....|:     .:....|||:||...  :|||::||..::.:..:|..:.|    ||:..
  Fly   376 EWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCL----PPSTT 436

  Fly   146 TV-----DISGWGAISQ-RGPISNSLLYVQVKALSRESCQKTY-----LRQLPETTMCLLHPKDK 199
            .:     .::|||.... :..:.:.|..|.|:.:|.:.||:.:     ...:.:..:|..: ||.
  Fly   437 KLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCAGY-KDG 500

  Fly   200 G--ACYGDSGGP--ATYQGK--LVGLASFVIGGCGRA-APDGYERVSKLRNWI 245
            |  :|.||||||  .|..|:  |:||.|:.| ||||. .|..|..:.:...||
  Fly   501 GRDSCQGDSGGPLTLTMDGRKTLIGLVSWGI-GCGREHLPGVYTNIQRFVPWI 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 74/246 (30%)
Tryp_SPc 28..248 CDD:238113 75/247 (30%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 74/246 (30%)
Tryp_SPc 316..555 CDD:238113 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.