DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Np

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:250 Identity:83/250 - (33%)
Similarity:127/250 - (50%) Gaps:38/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPRIVGGTKAREGQFPHQISLRR-RGS---HTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQ 85
            |||||||..|..|::|.|||||: |.|   |.||.:::::::.:||||||   :|| |.::|.::
  Fly   795 EPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCV---DNV-PPSDLLLR 855

  Fly    86 AGSLLLSS-----GGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAIKLATEDPPN 143
            .|...|:.     |.....|..|..||.::..  .:|:|:||....:.|..||..:.:    |.|
  Fly   856 LGEYDLAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCV----PDN 916

  Fly   144 D-----ATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKT-----YLRQLPETTMCLLHPK- 197
            |     .|..::|||.:.:.||:.:.|..|.|..::...|:..     |:..:|...:|....| 
  Fly   917 DENFIGQTAFVTGWGRLYEDGPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKG 981

  Fly   198 DKGACYGDSGGPATYQGK------LVGLASFVIGGCGRA-APDGYERVSKLRNWI 245
            ...:|.||||||...|.:      |.|:.|:.| ||..| .|..|.|:|:.|:||
  Fly   982 GYDSCEGDSGGPMVLQRESDKRFHLGGVISWGI-GCAEANQPGVYTRISEFRDWI 1035

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 79/246 (32%)
Tryp_SPc 28..248 CDD:238113 79/246 (32%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 79/246 (32%)
Tryp_SPc 798..1038 CDD:238113 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.