DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and flz

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:247 Identity:73/247 - (29%)
Similarity:113/247 - (45%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRR---GSHT---CGGSIISKDYVVTAAHCVKQG---NNVAPANEL 82
            |||||..:..|.:|.|:.:|..   |..|   |||.:|:..||:||||| :.|   :.||...|.
  Fly  1448 RIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC-QPGFLASLVAVMGEF 1511

  Fly    83 EIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDA 145
            :|...  |.|...|...|..|.||..|:  :..:|:|:|.|.:.:.|:::|..|.:     |||.
  Fly  1512 DISGD--LESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICM-----PNDV 1569

  Fly   146 T------VDISGWGAISQRGPISNSLLYVQVKALSRESCQKTY-----LRQLPETTMCLLHPK-D 198
            .      ..::|||.:...|.:.:.|..|||..:....||:.:     .:::..:.:|..:.. .
  Fly  1570 ADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGYANGQ 1634

  Fly   199 KGACYGDSGGPATYQG-----KLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            |.:|.||||||...|.     :|.|..|..|.......|..|.|.:..:.|:
  Fly  1635 KDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 72/245 (29%)
Tryp_SPc 28..248 CDD:238113 72/246 (29%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 72/246 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457798
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.