DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG8738

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:327 Identity:83/327 - (25%)
Similarity:128/327 - (39%) Gaps:94/327 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LCAAGVLAQNDS-VVEPRI-----VG----------GTKAREG---------------------- 37
            ||:.||:.::.. :::|||     .|          |.:..||                      
  Fly   130 LCSTGVVNEDGRYIIKPRINEESNFGCRVVEECCPLGDQIEEGRNPIQRNVKDFLLKGCGYSNPK 194

  Fly    38 -----------------QFPHQISLR-RRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANE--L 82
                             :||..::|. ..|:..|||::|....|:|:||      ||...:|  |
  Fly   195 GLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAH------NVFNRSEDSL 253

  Fly    83 EIQAGSLLLSSGGVRVP-----VATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKLATED 140
            .::||...|:|.....|     ::.:..|.|:|:..  :|:|::.|........:|..|.|...:
  Fly   254 LVRAGDWDLNSQTELHPYQMRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPE 318

  Fly   141 PP------NDATVDISGWG-AISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHP-- 196
            .|      ..|:...:||| ..|....:.|.|..:::.|:..||||: .||.........|||  
  Fly   319 TPQMEAELRSASCLATGWGLRYSTSRTMENLLKRIELPAVDHESCQR-LLRHTVLGRRYNLHPSF 382

  Fly   197 ------KDKGACYGDSGGP--ATYQG-----KLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEK 248
                  |.|..|.||.|.|  .|..|     :||||.|:.|....:..|..|..|:.|||||.|:
  Fly   383 TCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQ 447

  Fly   249 AS 250
            .:
  Fly   448 VT 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 75/303 (25%)
Tryp_SPc 28..248 CDD:238113 76/305 (25%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 71/246 (29%)
Tryp_SPc 207..444 CDD:214473 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.