DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Jon44E

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:273 Identity:76/273 - (27%)
Similarity:122/273 - (44%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLAQNDS------------VVEPRIVGGTKAREGQFPHQISLR-RRGSHTCGGSIISK 60
            |.:.:|||:....:            .:|.||..|..|.||:.|:.:.|. ..|.:.||||||..
  Fly    10 LAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDH 74

  Fly    61 DYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVR--------VPVATVTVHPNYNS-NGHDV 116
            .:|:|||||....|:|            |:......|        |..:.:..||::|. ..:|:
  Fly    75 TWVLTAAHCTNSANHV------------LIYFGASFRHEAQYTHWVSRSDMIQHPDWNDFLNNDI 127

  Fly   117 AVLRLRNSLTFNSNIAAIKLAT-EDPPNDAT---VDISGWGAISQRGPISNSLLYVQVKALSRES 177
            |::|:.: :.|.|.:..::|.: .|..|..:   ...||||.......:||.|..|.|:.:....
  Fly   128 ALIRIPH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNND 191

  Fly   178 CQKTY-LRQLPETTMCLLHPKDKGACYGDSGGPATY--QGKLVGLASFVIG-GCGRAAPDGYERV 238
            |:..| ...:.:.|:|:.....|.:|.||||||...  ..::||:.||..| ||....|.|:.||
  Fly   192 CRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRIVGIVSFGSGEGCTAGRPAGFTRV 256

  Fly   239 SKLRNWIAEKASL 251
            :...:||.:...:
  Fly   257 TGYLDWIRDHTGI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/235 (29%)
Tryp_SPc 28..248 CDD:238113 70/237 (30%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 69/235 (29%)
Tryp_SPc 41..266 CDD:238113 70/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.