DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG30371

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:262 Identity:66/262 - (25%)
Similarity:114/262 - (43%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CAAGVLAQNDSV---VEPRIVGGTKAREGQFPHQISLR---RRGSHTCGGSIISKDYVVTAAHCV 70
            |....:.||.:.   ...||..|.:|...:||...:|:   :..:..|||:|::..|::|||||:
  Fly   131 CTLTTVKQNCNCGWSATTRIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCI 195

  Fly    71 KQGNN------VAPANELEIQAGSLLLSSGGVR--VPVATVTVHPNYNSNGHDVAVLRLRNSLTF 127
            .|.:.      :...|:|...:.|.......::  :|.......|:.|   :|:|||...:::.:
  Fly   196 YQVSRATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVN---NDIAVLITASNIQW 257

  Fly   128 NSNIAAIKL---ATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTY--LRQLP 187
            :..:..|.|   .|..|.....||:.|:|.:...||.|.||..:.:..::.:.||..|  :..:.
  Fly   258 SRGVGPICLPPVGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEYNNVATIY 322

  Fly   188 ETTMCLLHPKDKG--ACYGDSGGPATYQGK---LVGLASFVIGGCGRAAPDGYE-RVSKLRNWIA 246
            ...||.......|  :|..|||||...:..   |||:.|:.........|.|.. |::...:||.
  Fly   323 TGQMCTYDYSGTGRDSCQFDSGGPVILRKSRQFLVGIISYGKSCAESQYPMGVNTRITSYISWIR 387

  Fly   247 EK 248
            :|
  Fly   388 QK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 60/239 (25%)
Tryp_SPc 28..248 CDD:238113 61/241 (25%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 60/239 (25%)
Tryp_SPc 150..389 CDD:238113 61/241 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.